PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn055041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 172aa    MW: 18820.6 Da    PI: 8.1249
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn055041genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.91.1e-40131121100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+l+r+C++ C +apyf +++pkkfa vhk+FGasnv+k+l+++ ee+r+da++slvyeAear+rdPvyG++g i  lq+++ +l+++l+++++
  Achn055041  13 SCAACKFLKRRCSPTCLFAPYFRSDEPKKFAQVHKVFGASNVSKILAEVAEEHRHDAVNSLVYEAEARLRDPVYGCIGAIAILQRKMVELQQDLDVARK 111
                 6*********************************************************************************************99987 PP

      DUF260 100 e 100
                 +
  Achn055041 112 R 112
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.92512113IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-4013110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MVKGGHEPRS SGSCAACKFL KRRCSPTCLF APYFRSDEPK KFAQVHKVFG ASNVSKILAE  60
VAEEHRHDAV NSLVYEAEAR LRDPVYGCIG AIAILQRKMV ELQQDLDVAR KRLARCAAGV  120
SPLSLLQDDQ FLVNSLSEFL PLVPGYSGWG EGFNQSGSSS MDELSQLLFP K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002272821.12e-68PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL85e-60LBD21_ARATH; LOB domain-containing protein 21
TrEMBLD7T4L72e-68D7T4L7_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g01450.t015e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.13e-61LOB domain-containing protein 21